PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB06G12380.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 266aa    MW: 27500.9 Da    PI: 9.488
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB06G12380.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.41.2e-0899152255
                   T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
      Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                   rk+ +++k+q  +Lee+F+ +++++ +++  LA++l+L  rq     qNrR + 
  OB06G12380.1  99 RKKLRLSKDQAAVLEECFKAHHTLTPKQKLALANSLSLRPRQGEGGVQNRRGRT 152
                   788899**********************************99777777777665 PP

2HD-ZIP_I/II99.33.6e-3299189192
   HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                   +kk+rlsk+q+++LEe+F+++++L+p++K +la++L l+prq +   qnrR Rtk+kq+E+d+e+Lkr++d+l+++n+rL+ke +eLr +lk
  OB06G12380.1  99 RKKLRLSKDQAAVLEECFKAHHTLTPKQKLALANSLSLRPRQGEGGVQNRRGRTKLKQTEVDCEQLKRWCDQLADHNRRLHKELAELR-ALK 189
                   69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.4E-973156IPR009057Homeodomain-like
SuperFamilySSF466891.1E-886156IPR009057Homeodomain-like
PROSITE profilePS5007110.33395155IPR001356Homeobox domain
SMARTSM003895.8E-497159IPR001356Homeobox domain
PfamPF000465.3E-699152IPR001356Homeobox domain
CDDcd000864.58E-699156No hitNo description
SMARTSM003403.2E-19155198IPR003106Leucine zipper, homeobox-associated
PfamPF021839.6E-11155189IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MERQSLDLGL SLGLGLGVTS TAAPRLPPPA PPPRPLSSGV AIASEQEGSH GAVAAEDERV  60
APCSPGSPVS SGSGKRTADR SAGSGDEDDA GCDGGGGARK KLRLSKDQAA VLEECFKAHH  120
TLTPKQKLAL ANSLSLRPRQ GEGGVQNRRG RTKLKQTEVD CEQLKRWCDQ LADHNRRLHK  180
ELAELRALKA TPPAAAETPL TTLTMCLSCK RVATSSSASA ANAGAPSPFP GHHPQFFCGF  240
RDSAAGATAA AYGSSSGLAK PVRAAR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1147155RRGRTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8308961e-165CT830896.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSN014L20, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015693446.11e-126PREDICTED: homeobox-leucine zipper protein HOX28-like, partial
SwissprotA2Y9313e-77HOX28_ORYSI; Homeobox-leucine zipper protein HOX28
SwissprotQ5VPE53e-77HOX28_ORYSJ; Homeobox-leucine zipper protein HOX28
TrEMBLJ3MB440.0J3MB44_ORYBR; Uncharacterized protein
STRINGOB06G12380.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38423376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.11e-36homeobox from Arabidopsis thaliana